PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496332.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 231aa    MW: 25341.2 Da    PI: 6.9698
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496332.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.12.6e-42741731100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+++la
  XP_004496332.1  74 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPEPQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQTQLA 168
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_004496332.1 169 KAQAE 173
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.99273174IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4274171IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MEQLKVKTTT SPPYLPIPIH VPIHTMFSNS PPSSSSSPPS QSPTPFPSPP SQSSPPNLAT  60
PQPPSPPPPI VVSPCAACKI LRRRCVEKCV LAPYFPPTDP LKFTIAHRVF GASNIIKFLQ  120
ELPEPQRADA VSSMVYEANA RIRDPVYGCA GAICQLQKQV SELQTQLAKA QAELVNMHCQ  180
QANLVALICM EMSQSQQDHN NMIIQPQPNV DMSCFLEDNN SFGSAWEPLW T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1444841e-117AC144484.5 Medicago truncatula clone mth2-30o16, complete sequence.
GenBankAC1528181e-117AC152818.17 Medicago truncatula clone mth2-85g12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496332.11e-168PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-77LBD1_ARATH; LOB domain-containing protein 1
TrEMBLG7I9N11e-112G7I9N1_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA20G31780.11e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-74LOB domain-containing protein 1